Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

15-Lipoxygenase 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258984

Catalog No. NBP258984


Add to cart

Description

Description

15-Lipoxygenase 2 Polyclonal antibody specifically detects 15-Lipoxygenase 2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

15-Lipoxygenase 2
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase
Rabbit
IgG
100 ul
Lipid and Metabolism
Primary
247
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
ALOX15B
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FRAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWAD
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only