Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

15-Lipoxygenase 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155145

 View more versions of this product

Catalog No. NBP155145


Add to cart

Description

Description

15-Lipoxygenase 2 Polyclonal antibody specifically detects 15-Lipoxygenase 2 in Human, Mouse, Rat, Porcine, Bovine, Equine, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

15-Lipoxygenase 2
Unconjugated
PBS & 2% sucrose. with 0.09% Sodium Azide
Affinity Purified
ALOX15B
Synthetic peptides corresponding to ALOX15B(arachidonate 15-lipoxygenase, type B) The peptide sequence was selected from the N terminal of ALOX15B (NP_001034220), Peptide sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE.
67 kDa
100 ul
Lipid and Metabolism
Primary
247
Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Western Blot
Western Blot 0.2-1 ug/ml
O15296
15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge vial prior to reconstitution. Reconstitute with 50μL distilled water to a final antibody concentration of 1mg/mL.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit