Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
15-Lipoxygenase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | 15-Lipoxygenase 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15514520
|
Novus Biologicals
NBP15514520UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP155145
|
Novus Biologicals
NBP155145 |
100 μL |
Each for $482.50
|
|
|||||
Description
15-Lipoxygenase 2 Polyclonal specifically detects 15-Lipoxygenase 2 in Human samples. It is validated for Western Blot.Specifications
| 15-Lipoxygenase 2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| 15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase | |
| ALOX15B | |
| IgG | |
| 67 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O15296 | |
| 247 | |
| Synthetic peptides corresponding to ALOX15B(arachidonate 15-lipoxygenase, type B) The peptide sequence was selected from the N terminal of ALOX15B (NP_001034220), Peptide sequence MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title