Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
4930567H17Rik Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198255
Description
4930567H17Rik Polyclonal specifically detects 4930567H17Rik in Mouse samples. It is validated for Western Blot.Specifications
4930567H17Rik | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
NP_001028979 | |
4930567H17RIK | |
The immunogen for this antibody is 4930567H17Rik. Peptide sequence TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE. | |
Affinity Purified | |
RUO | |
619303 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
4930567H17Rik RIKEN cDNA 4930567H17 gene | |
Rabbit | |
27 kDa | |
100 μL | |
Primary | |
Dog: 86%; Bovine: 86%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Yeast, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title