5-HT2B Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP155429

Catalog No. NBP155429

Description

5-HT2B Polyclonal specifically detects 5-HT2B in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: 5-HT2B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Gene Accession No.: P41595
• Gene Symbols: HTR2B
• Immunogen: Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: 5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Research Discipline: GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 3357
• Target Species: Human, Mouse, Porcine, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG