Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
5-HT2B Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP15542920UL
Description
5-HT2B Polyclonal specifically detects 5-HT2B in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
5-HT2B | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:10-1:2000 | |
P41595 | |
HTR2B | |
Synthetic peptides corresponding to HTR2B(5-hydroxytryptamine (serotonin) receptor 2B) Antibody(against the N terminal of 5HT2B Receptor. Peptide sequence QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Mouse | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
5-HT(2B), 5-HT-2B, 5-HT2B5-HT 2B receptor, 5-hydroxytryptamine (serotonin) receptor 2B, 5-hydroxytryptamine 2B receptor, 5-hydroxytryptamine receptor 2B, Serotonin receptor 2B | |
Rabbit | |
54 kDa | |
20 μL | |
GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
3357 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title