Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ 53BP1 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

$230.50

Specifications

Product Type Recombinant Protein Antigen
Recombinant Yes
Regulatory Status RUO
Storage Requirements Store at −20°C. Avoid freeze-thaw cycles.
Gene Symbol TP53BP1
View More Specs

Products 2
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
NBP254659X View Documents Novus Biologicals™
NBP254659PEP
AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL Each for $230.50
Add to cart
 
NBP254677X View Documents Novus Biologicals™
NBP254677PEP
VPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA Each for $230.50
Add to cart
 
Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 53BP1 The 53BP1 Recombinant Protein Antigen is derived from E. coli. The 53BP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Recombinant Protein Antigen
RUO
TP53BP1
53BP1 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4
E.coli
Unlabeled
Yes
Store at −20°C. Avoid freeze-thaw cycles.
53BP1, MGC138366, p202
>80% by SDS-PAGE and Coomassie blue staining
Human
PAGE

For Research Use Only.

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit