Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | ABCA5 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15980920
|
Novus Biologicals
NBP15980920UL |
20 μL |
Each for $152.22
|
|
NBP159809
|
Novus Biologicals
NBP159809 |
100 μL |
Each for $436.00
|
|
Description
ABCA5 Polyclonal specifically detects ABCA5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ABCA5 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
Q8WWZ7 | |
23461 | |
Synthetic peptides corresponding to ABCA5(ATP-binding cassette, sub-family A (ABC1), member 5) The peptide sequence was selected from the C terminal of ABCA5. Peptide sequence HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ABC13, ATP-binding cassette A5, ATP-binding cassette sub-family A member 5, ATP-binding cassette, sub-family A (ABC1), member 5, DKFZp451F117, DKFZp779N2435, EC 3.6.3, EC 3.6.3.25, EC 3.6.3.41, EST90625, FLJ16381, KIAA1888 | |
ABCA5 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title