Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCB1 Rabbit anti-Human, Mouse, Rat, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.

Manufacturer:  Abnova Corporation PAB29562

Catalog No. 89-933-498


Add to cart

Description

Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. [provided by RefSeq]

Sequence: IYFKLVTMQTAGNEVELENAADESKSEIDA
Specifications

Specifications

ABCB1
Unconjugated
Immunohistochemistry (Frozen sections) (0.5-1 ug/mL) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL) The optimal working dilution should be determined by the end user.
Lyophilized
ABCB1
A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1.
Immunogen affinity purification
RUO
Primary
5243
Immunohistochemistry (Frozen), Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
Lyophilized from 0.9mg NaCl, 0.2mg Na
ABC20/CD243/CLCS/GP170/MDR1/MGC163296/P-GP/PGY1
Rabbit
IgG
100 ug
Store at −20°C. After reconstitution with 0.2mLof deionized water, store at 4°C for 1 month. For long term storage store at −20°C. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human, Murine, Rat
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit