ABCB10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169066

Catalog No. NBP169066

Description

ABCB10 Polyclonal specifically detects ABCB10 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ABCB10
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9JI39
• Gene Symbols: Abcb10
• Immunogen: Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10) The peptide sequence was selected from the N terminal of Abcb10. Peptide sequence NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23456
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 77 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG