Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCB10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ABCB10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP169066
View Documents
Novus Biologicals
NBP169066
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ABCB10 Polyclonal specifically detects ABCB10 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

ABCB10
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial
Abcb10
IgG
Affinity Purified
77 kDa
Western Blot
Unconjugated
RUO
Q9JI39
23456
Synthetic peptides corresponding to Abcb10 (ATP-binding cassette, sub-family B (MDR/TAP), member 10) The peptide sequence was selected from the N terminal of Abcb10. Peptide sequence NGIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit