Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCB10 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen ABCB10
Immunogen The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16906520 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16906520UL
20ul Each for $149.00
Add to cart
 
NBP169065 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169065
100 ul Each for $329.00
Add to cart
 
Description

Description

ABCB10 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

ABCB10
Rabbit
Polyclonal
Unconjugated
23456
Affinity Purified
Western Blot
RUO
The immunogen for anti-Abcb10 antibody: synthetic peptide corresponding to a region of Rat (NP_001012166). Peptide sequence TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
Primary
IgG
ABC transporter 10 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 10, EC 3.6.3, EC 3.6.3.44, EST20237, M-ABC2ATP-binding cassette transporter 10, Mitochondrial ATP-binding cassette 2, MTABC2ATP-binding cassette sub-family B member 10, mitochondrial
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit