ABCC12 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169063

Catalog No. NBP169063

Description

ABCC12 Polyclonal specifically detects ABCC12 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ABCC12
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q80WJ6
• Gene Symbols: Abcc12
• Immunogen: Synthetic peptides corresponding to Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94160
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP-binding cassette transporter sub-family C member 12, ATP-binding cassette, sub-family C (CFTR/MRP), member 12, MGC27071, MRP9ATP-binding cassette sub-family C member 12, multidrug resistance-associated protein 9
• Host Species: Rabbit
• Molecular Weight of Antigen: 153 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.