Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCC12 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ABCC12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP169063
|
Novus Biologicals
NBP169063 |
100 μL |
Each for $436.00
|
|
NBP16906320
|
Novus Biologicals
NBP16906320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ABCC12 Polyclonal specifically detects ABCC12 in Mouse samples. It is validated for Western Blot.Specifications
| ABCC12 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ATP-binding cassette transporter sub-family C member 12, ATP-binding cassette, sub-family C (CFTR/MRP), member 12, MGC27071, MRP9ATP-binding cassette sub-family C member 12, multidrug resistance-associated protein 9 | |
| Abcc12 | |
| IgG | |
| Affinity Purified | |
| 153 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q80WJ6 | |
| 94160 | |
| Synthetic peptides corresponding to Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title