Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABCD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ABCD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159808
|
Novus Biologicals
NBP159808 |
100 μL |
Each for $436.00
|
|
NBP15980820
|
Novus Biologicals
NBP15980820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ABCD2 Polyclonal specifically detects ABCD2 in Human samples. It is validated for Western Blot.Specifications
| ABCD2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein, ALD1, ALDL1ATP-binding cassette sub-family D member 2, ALDRhALDR, ALDRPABC39, ATP-binding cassette, sub-family D (ALD), member 2 | |
| ABCD2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UBJ2 | |
| 225 | |
| Synthetic peptides corresponding to ABCD2(ATP-binding cassette, sub-family D (ALD), member 2) The peptide sequence was selected from the middle region of ABCD2. Peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title