Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ABCD4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159807
View Documents
Novus Biologicals
NBP159807
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ABCD4 Polyclonal specifically detects ABCD4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ABCD4
Polyclonal
Purified
RUO
ATP-binding cassette sub-family D member 4, ATP-binding cassette, sub-family D (ALD), member 4, EST352188, P70R69 kDa peroxisomal ABC-transporter, Peroxisomal membrane protein 1-like, Peroxisomal membrane protein 69, PMP69P79R, PMP70-related protein, PXMP1-L, PXMP1LABC41
ABCD4
IgG
Protein A purified
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
5826
Synthetic peptides corresponding to ABCD4(ATP-binding cassette, sub-family D (ALD), member 4) The peptide sequence was selected from the C terminal of ABCD4. Peptide sequence FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit