Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen ABCD4
Immunogen Synthetic peptides corresponding to ABCD4(ATP-binding cassette, sub-family D (ALD), member 4) The peptide sequence was selected from the C terminal of ABCD4. Peptide sequence FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15980720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15980720UL
20ul Each for $149.00
Add to cart
 
NBP159807 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159807
100ul Each for $299.00
Add to cart
 
Description

Description

ABCD4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ABCD4
Rabbit
Polyclonal
Unconjugated
5826
Purified
Western Blot
RUO
Synthetic peptides corresponding to ABCD4(ATP-binding cassette, sub-family D (ALD), member 4) The peptide sequence was selected from the C terminal of ABCD4. Peptide sequence FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA.
Primary
IgG
ATP-binding cassette sub-family D member 4, ATP-binding cassette, sub-family D (ALD), member 4, EST352188, P70R69 kDa peroxisomal ABC-transporter, Peroxisomal membrane protein 1-like, Peroxisomal membrane protein 69, PMP69P79R, PMP70-related protein, PXMP1-L, PXMP1LABC41
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit