ABHD13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159479

Catalog No. NBP159479

Description

ABHD13 Polyclonal specifically detects ABHD13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ABHD13
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7L211
• Gene Symbols: ABHD13
• Immunogen: Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the C terminal of ABHD13. Peptide sequence LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 84945
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: abhydrolase domain containing 13, abhydrolase domain-containing protein 13, bA153I24.2, BEM46L1, C13orf6, chromosome 13 open reading frame 6, EC 3.-, FLJ14906, MGC27058, RP11-153I24.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Equine: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG