Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ABHD13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ABHD13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159479
|
Novus Biologicals
NBP159479 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ABHD13 Polyclonal specifically detects ABHD13 in Human samples. It is validated for Western Blot.Specifications
| ABHD13 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q7L211 | |
| 84945 | |
| Synthetic peptides corresponding to ABHD13(abhydrolase domain containing 13) The peptide sequence was selected from the C terminal of ABHD13. Peptide sequence LAIFPDGTHNDTWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| abhydrolase domain containing 13, abhydrolase domain-containing protein 13, bA153I24.2, BEM46L1, C13orf6, chromosome 13 open reading frame 6, EC 3.-, FLJ14906, MGC27058, RP11-153I24.2 | |
| ABHD13 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title