Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACAA1 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15515620UL
Description
ACAA1 Polyclonal specifically detects ACAA1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ACAA1 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
P09110 | |
ACAA1 | |
Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT | |
Affinity Purified | |
RUO | |
30 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal | |
Rabbit | |
44 kDa | |
20 μL | |
Primary | |
Human, Rat | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title