ACAA1 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155156

Catalog No. NBP155156

Description

ACAA1 Polyclonal specifically detects ACAA1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ACAA1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P09110
• Gene Symbols: ACAA1
• Immunogen: Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 1, EC 2.3.1, peroxisomal
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes, Signal Transduction
• Gene ID (Entrez): 30
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG