Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACAA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ACAA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15474620
|
Novus Biologicals
NBP15474620UL |
20 μL |
Each for $152.22
|
|
NBP154746
|
Novus Biologicals
NBP154746 |
100 μL |
Each for $436.00
|
|
Description
ACAA2 Polyclonal specifically detects ACAA2 in Human samples. It is validated for Western Blot.Specifications
| ACAA2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 3-ketoacyl-CoA thiolase, mitochondrial, Acetyl-CoA acyltransferase, acetyl-CoA acyltransferase 2, acetyl-Coenzyme A acyltransferase 2, beta ketothiolase, beta-ketothiolase, DSAEC, EC 2.3.1, EC 2.3.1.16, FLJ35992, FLJ95265, Mitochondrial 3-oxoacyl-CoA thiolase, mitochondrial 3-oxoacyl-Coenzyme A thiolase, T1 | |
| ACAA2 | |
| IgG | |
| Affinity Purified | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P42765 | |
| 10449 | |
| Synthetic peptides corresponding to ACAA2(acetyl-Coenzyme A acyltransferase 2) The peptide sequence was selected from the N terminal of ACAA2. Peptide sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title