Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACAD8 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ACAD8 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126157
|
Novus Biologicals
NBP310628100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
ACAD8 Polyclonal specifically detects ACAD8 in Rat samples. It is validated for Western Blot.Specifications
ACAD8 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
PBS buffer, 2% sucrose | |
27034 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Rat | |
ACAD-8, Activator-recruited cofactor 42 kDa component, Acyl-CoA dehydrogenase family member 8, acyl-CoA dehydrogenase family, member 8, acyl-Coenzyme A dehydrogenase family, member 8, ARC42, EC 1.3.99, EC 1.3.99.-, FLJ22590, IBD, isobutyryl-CoA dehydrogenase, mitochondrial | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat ACAD8 (XP_001053896). Peptide sequence LFPVDVMRKAAQLGFGGIYVRTDVGGSGLSRLDTSVIFEALATGCTSTTA | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title