Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACAT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ACAT |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18054720
|
Novus Biologicals
NBP18054720UL |
20 μL |
Each for $152.22
|
|
NBP180547
|
Novus Biologicals
NBP180547 |
100 μL |
Each for $436.00
|
|
Description
ACAT Polyclonal specifically detects ACAT in Human samples. It is validated for Western Blot.Specifications
| ACAT | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P35610 | |
| 6646 | |
| Synthetic peptide directed towards the middle region of human SOAT1 (NP_003092). Peptide sequence ASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ACACT, ACACT1, ACAT-1, ACATACAT1, acyl-Coenzyme A: cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase 1, Cholesterol acyltransferase 1, EC 2.3.1.26, RP11-215I23.2, STATSOAT, sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1, sterol O-acyltransferase 1 | |
| SOAT1 | |
| IgG | |
| Affinity Purified | |
| 65 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title