Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ACBD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159995
|
Novus Biologicals
NBP159995 |
100 μL |
Each for $436.00
|
|
NBP15999520
|
Novus Biologicals
NBP15999520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ACBD4 Polyclonal specifically detects ACBD4 in Human samples. It is validated for Western Blot.Specifications
| ACBD4 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| acyl-CoA binding domain containing 4, acyl-CoA-binding domain-containing protein 4, acyl-Coenzyme A binding domain containing 4, FLJ13322, FLJ90623 | |
| ACBD4 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NC06 | |
| 79777 | |
| Synthetic peptides corresponding to ACBD4(acyl-Coenzyme A binding domain containing 4) The peptide sequence was selected from the N terminal of ACBD4. Peptide sequence MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title