Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACD Antibody, Novus Biologicals™

Name: ACD Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP258187
Price: 627.50 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP258187

Catalog No. NBP258187

$627.50 / Each of 1

Qty

Add to Cart

Description

ACD Polyclonal specifically detects ACD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	ACD
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias	adrenocortical dysplasia homolog (mouse), Pip1, PIP1Tint1, POT1 and TIN2 organizing protein, POT1 and TIN2-interacting protein, Ptop, PTOPTpp1, TIN2 interacting protein 1, TINT1adrenocortical dysplasia protein homolog, TPP1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	65057
Target Species	Human
Isotype	IgG

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	ACD
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS
Quantity	100 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only

Spot an opportunity for improvement?

Provide Content Correction

ACD Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions