Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Achaete Rabbit anti-Drosophila, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179448

 View more versions of this product

Catalog No. NBP179448

Add to cart



Achaete Polyclonal antibody specifically detects Achaete in Human, Rat, Drosophila samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA.
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
990 E5 F1, Ac, ac achaete, Ac/Sc, ASC, AS-C T5, AS-C T5ac, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: House fly: 92%; Blue blowfly: 92%; African malaria mosquito: 85%; Red flour beetle: 85%; Silk moth: 85%; Yellowfever mosquito: 85%; Mosquito: 85%; Harpegnathos saltator: 85%; Camponotus floridanus: 85%; Southern house mosquito: 85%; Caribbean spiny lobster: 85%; Mediterranean fruit fly: 84%; Starlet sea anemone: 83%; Drosophila quadrilineata: 78%; Body louse: 78%; Drosophila sordidula: 78%; Drosophila pavani: 78%; Drosophila paramelanica: 78%; Drosophila nigromelanica: 78%; Drosophila micromelanica: 78%; Drosophila macrospina: 78%; Drosophila gaucha: 78%; Drosophila euronotus: 78%; Drosophila colorata: 78%; Triops longicaudatus: 78%.
Drosophila, Human, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit