Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Achaete Rabbit anti-Drosophila, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17944820UL

 View more versions of this product

Catalog No. NBP17944820


Add to cart

Description

Description

Achaete Polyclonal antibody specifically detects Antigen in Drosophila samples. It is validated for Western Blotting.
Specifications

Specifications

Achaete
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
ac
The specific Immunogen is proprietary information. Peptide sequence FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA.
Immunogen affinity purified
RUO
Primary
30981
Western Blot
Western Blot 1:1000
NP_476824
990 E5 F1, Ac, ac achaete, Ac/Sc, ASC, AS-C T5, AS-C T5ac, ascT5, CG3796, Dmel\CG3796, EG:125H10.3, Hw, sc/T5, T5
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Drosophila
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit