ACP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162491

Catalog No. NBP162491

Description

ACP2 Polyclonal specifically detects ACP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ACP2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
• Gene Accession No.: P11117
• Gene Symbols: ACP2
• Immunogen: Synthetic peptides corresponding to ACP2(acid phosphatase 2, lysosomal) The peptide sequence was selected from the middle region of ACP2 (NP_001601). Peptide sequence VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: acid phosphatase 2, lysosomal, EC 3.1.3.2, LAP, lysosomal acid phosphatase
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 53
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.