Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | ACP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB7424120UL
|
Novus Biologicals
NBP17424120UL |
20 μL |
Each for $204.00
|
|
|||||
NBP174241
|
Novus Biologicals
NBP174241 |
100 μL |
Each for $482.50
|
|
|||||
Description
ACP2 Polyclonal specifically detects ACP2 in Rat samples. It is validated for Western Blot.Specifications
ACP2 | |
Polyclonal | |
Rabbit | |
Q642D2 | |
53 | |
Synthetic peptides corresponding to the middle region of Acp2. Immunizing peptide sequence GQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAGLFPPTEVQH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
acid phosphatase 2, lysosomal, EC 3.1.3.2, LAP, lysosomal acid phosphatase | |
ACP2 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title