Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACP6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ACP6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154870
|
Novus Biologicals
NBP154870 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ACP6 Polyclonal specifically detects ACP6 in Human samples. It is validated for Western Blot.Specifications
| ACP6 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q9NPH0 | |
| 51205 | |
| Synthetic peptides corresponding to ACP6(acid phosphatase 6, lysophosphatidic) The peptide sequence was selected from the N terminal of ACP6. Peptide sequence EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| acid phosphatase 6, lysophosphatidicPACPL1, Acid phosphatase-like protein 1, ACPL1acid phosphatase like 1, EC 3.1.3.2, LPAPlysophosphatidic acid phosphatase type 6 | |
| ACP6 | |
| IgG | |
| Affinity Purified | |
| 49 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title