Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACPT Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16244020UL
Description
ACPT Polyclonal specifically detects ACPT in Human samples. It is validated for Western Blot.Specifications
ACPT | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9BZG2 | |
ACPT | |
Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND. | |
Affinity Purified | |
RUO | |
93650 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
acid phosphatase, testicular, EC 3.1.3.2, testicular acid phosphatase | |
Rabbit | |
43 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title