Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACSF2 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ACSF2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174274
|
Novus Biologicals
NBP174274 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ACSF2 Polyclonal specifically detects ACSF2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| ACSF2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q8VCW8 | |
| 80221 | |
| Synthetic peptides corresponding to thetase family member 2 Antibody against the C terminal of ACSF2. Immunizing peptide sequence DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ACSMW, acyl-CoA synthetase family member 2, AVYV493, EC 6.2.1, EC 6.2.1.-, EC 6.2.1.26, mitochondrial, PPARG binding, long chain fatty acid acyl Co-A ligase like | |
| ACSF2 | |
| IgG | |
| Affinity Purified | |
| 68 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title