Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACSF2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ACSF2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP174274
View Documents
Novus Biologicals
NBP174274
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ACSF2 Polyclonal specifically detects ACSF2 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

ACSF2
Polyclonal
Rabbit
Lipid and Metabolism
Q8VCW8
80221
Synthetic peptides corresponding to thetase family member 2 Antibody against the C terminal of ACSF2. Immunizing peptide sequence DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
ACSMW, acyl-CoA synthetase family member 2, AVYV493, EC 6.2.1, EC 6.2.1.-, EC 6.2.1.26, mitochondrial, PPARG binding, long chain fatty acid acyl Co-A ligase like
ACSF2
IgG
Affinity Purified
68 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit