Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACTH Rabbit anti-Human, Mouse, Non-human Primate, Rat, FITC, Polyclonal, FabGennix
Rabbit Polyclonal Antibody
Supplier: Fabgennix Inc ACTHFITC
Description
ACTH Polyclonal antibody specifically detects ACTH in Human, Mouse, Non-human Primate, Rat samples. It is validated for Dot Blot, ELISA, Immunocytochemistry, Immunohistochemistry, Immunomicroscopy, Immunoprecipitation, Western BlotSpecifications
ACTH | |
Polyclonal | |
FITC | |
Pomc | |
ACTH; adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alphaMSH; alpha-MSH; BE; beta-endorphin; Beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; Clip; Corticotropin; Corticotropin-like intermediary peptide; corticotropin-lipotropin; Gamma-LPH; gamma-MSH; Lipotropin beta; lipotropin gamma; LPH; Melanocyte-stimulating hormone alpha; Melanocyte-stimulating hormone beta; Melanotropin alpha; melanotropin beta; Melanotropin gamma; met-enkephalin; MSH; NPP; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POC; Pomc; Pomc1; Pomc-1; Pomc2; Potential peptide; Precursor of MSH; pro-ACTH-endorphin; proopiomelanocortin; pro-opiomelanocortin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); pro-opiomelanocortin-alpha; proopoimelanocortin, beta (endorphin, beta) | |
Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF | |
200 μL | |
Primary | |
Human, Mouse, Non-human Primate, Rat | |
Antibody | |
IgG |
Dot Blot, ELISA, Immunocytochemistry, Immunohistochemistry, Immunomicroscopy, Immunoprecipitation, Western Blot | |
0.5-1.5 mg/mL | |
proprietary buffer with 0.5% BSA, 30% glycerol and 0.02% sodium azide; pH 7.4-7.8 | |
P01189, P01193, P01194 | |
Rabbit | |
Affinity chromatography | |
RUO | |
18976, 24664, 459074, 5443 | |
-20° C, store in dark | |
Liquid |
Product Content Correction
The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Product Content Correction