Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACTL6B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen ACTL6B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155478
View Documents
Novus Biologicals
NBP155478
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

ACTL6B Polyclonal specifically detects ACTL6B in Human samples. It is validated for Western Blot.
Specifications

Specifications

ACTL6B
Polyclonal
Rabbit
Extracellular Matrix
O94805
51412
Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
53 kDa BRG1-associated factor B, actin-like 6, actin-like 6B, Actin-related protein Baf53b, ACTL6, ArpNalpha, BAF53Bactin-like protein 6B, BRG1-associated factor 53B, hArpN alpha
ACTL6B
IgG
Affinity Purified
47 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit