Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ACTL7A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310804100UL
Description
ACTL7A Polyclonal specifically detects ACTL7A in Human samples. It is validated for Western Blot.Specifications
ACTL7A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
actin-like 7A, actin-like 7-alpha, actin-like protein 7A, actin-like-7-alpha | |
The immunogen is a synthetic peptide directed towards the middle region of human ACTL7A (NP_006678.1). Peptide sequence GYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVH | |
100 μg | |
Chromatin Research | |
10881 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction