Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACTR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15320120UL

 View more versions of this product

Catalog No. NBP1532020


Add to cart

Description

Description

ACTR2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

ACTR2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
actin-related protein 2, ARP2 (actin-related protein 2, yeast) homolog, ARP2 actin-related protein 2 homolog (yeast), ARP2Actin-like protein 2
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Purified
ACTR2
Synthetic peptides corresponding to ACTR2(ARP2 actin-related protein 2 homolog (yeast)) The peptide sequence was selected from the N terminal of ACTR2. Peptide sequence NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE.
45 kDa
20ul
Protein Kinase
Primary
10097
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit