Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADAM23 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen ADAM23
Immunogen Synthetic peptides corresponding to Adam23 (a disintegrin and metallopeptidase domain 23) The peptide sequence was selected from the C terminal of Adam23. Peptide sequence NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16901620 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16901620UL
20ul Each for $149.00
Add to cart
 
NBP169016 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169016
100 ul Each for $329.00
Add to cart
 
Description

Description

ADAM23 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

ADAM23
Rabbit
Polyclonal
Unconjugated
8745
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Adam23 (a disintegrin and metallopeptidase domain 23) The peptide sequence was selected from the C terminal of Adam23. Peptide sequence NPNPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFD.
Primary
IgG
a disintegrin and metalloproteinase domain 23, ADAM metallopeptidase domain 23, disintegrin and metalloproteinase domain-containing protein 23, MDC-3, MDC3ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit