Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAM30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ADAM30 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ADAM30 Polyclonal specifically detects ADAM30 in Human samples. It is validated for Western Blot.Specifications
ADAM30 | |
Polyclonal | |
Rabbit | |
Human | |
a disintegrin and metalloproteinase domain 30, ADAM 30, ADAM metallopeptidase domain 30, disintegrin and metalloproteinase domain-containing protein 30, EC 3.4.24.-, svph4 | |
ADAM30 | |
IgG | |
66 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9UKF2 | |
11085 | |
Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title