Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAM33 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ADAM33 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159046
|
Novus Biologicals
NBP159046 |
100 μL |
Each for $436.00
|
|
NBP15904620
|
Novus Biologicals
NBP15904620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
ADAM33 Polyclonal specifically detects ADAM33 in Human samples. It is validated for Western Blot.Specifications
ADAM33 | |
Polyclonal | |
Rabbit | |
Asthma, Cell Cycle and Replication, Immunology | |
Q9BZ11 | |
80332 | |
Synthetic peptides corresponding to ADAM33(ADAM metallopeptidase domain 33) The peptide sequence was selected from the middle region of ADAM33 (NP_079496). Peptide sequence HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
a disintegrin and metalloprotease 33, a disintegrin and metalloproteinase domain 33, ADAM 33, ADAM metallopeptidase domain 33, C20orf153, chromosome 20 open reading frame 153, disintegrin and metalloproteinase domain-containing protein 33, disintegrin and reprolysin metalloproteinase family protein, DJ964F7.1, DKFZp434K0521, EC 3.4.24.-, FLJ35308, FLJ36751, MGC149823, MGC71889 | |
ADAM33 | |
IgG | |
Affinity Purified | |
62 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title