Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAM8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310837100UL
Description
ADAM8 Polyclonal specifically detects ADAM8 in Mouse samples. It is validated for Western Blot.Specifications
| ADAM8 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| a disintegrin and metalloproteinase domain 8, ADAM 8, ADAM metallopeptidase domain 8, CD156a antigen, CD156human leukocyte differentiation antigen, Cell surface antigen MS2, EC 3.4.24, EC 3.4.24.-, MGC134985, MS2disintegrin and metalloproteinase domain-containing protein 8 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 (NP_031429.1). Peptide sequence GQYPESLSYALGTSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQ | |
| 100 μg | |
| Cellular Markers | |
| 101 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction