Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADAM8 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31083725UL

 View more versions of this product

Catalog No. NB126576


Add to cart

Description

Description

ADAM8 Polyclonal antibody specifically detects ADAM8 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

ADAM8
Unconjugated
PBS buffer, 2% sucrose
a disintegrin and metalloproteinase domain 8, ADAM 8, ADAM metallopeptidase domain 8, CD156a antigen, CD156human leukocyte differentiation antigen, Cell surface antigen MS2, EC 3.4.24, EC 3.4.24.-, MGC134985, MS2disintegrin and metalloproteinase domain-containing protein 8
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 (NP_031429.1). Peptide sequence GQYPESLSYALGTSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQ
25 μg
Cellular Markers
Primary
101
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Mouse
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit