Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADAMTS19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen ADAMTS19
Immunogen Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16917020 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16917020UL
20ul Each for $149.00
Add to cart
 
NBP169170 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169170
100 ul Each for $329.00
Add to cart
 
Description

Description

ADAMTS19 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

ADAMTS19
Rabbit
Polyclonal
Unconjugated
171019
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD
Primary
IgG
A disintegrin and metalloproteinase with thrombospondin motifs 19, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19, ADAM metallopeptidase with thrombospondin type 1 motif, 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC 3.4.24.-, FLJ16042
From PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit