Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAMTS19 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | ADAMTS19 |
|---|---|
| Immunogen | Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16917020 |
Novus Biologicals
NBP16917020UL |
20ul |
Each for $149.00
|
|
NBP169170 |
Novus Biologicals
NBP169170 |
100 ul |
Each for $329.00
|
|
Description
ADAMTS19 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| ADAMTS19 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 171019 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD | |
| Primary | |
| IgG | |
| A disintegrin and metalloproteinase with thrombospondin motifs 19, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 19, ADAM metallopeptidase with thrombospondin type 1 motif, 19, ADAM-TS 19, ADAM-TS19, ADAMTS-19, EC 3.4.24.-, FLJ16042 | |
| From PBS & 2% Sucrose. with No Preservative | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title