Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157220
Description
ADAT1 Polyclonal specifically detects ADAT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ADAT1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
adenosine deaminase acting on tRNA, adenosine deaminase, tRNA-specific 1, EC 3.5.4, EC 3.5.4.-, HADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase | |
Rabbit | |
Protein A purified | |
RUO | |
23536 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q9NVB7 | |
ADAT1 | |
Synthetic peptides corresponding to ADAT1 (adenosine deaminase, tRNA-specific 1) The peptide sequence was selected from the C terminal of ADAT1. Peptide sequence RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 78%; Zebrafish: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction