ADAT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15722020UL

Catalog No. NBP15722020

Description

ADAT1 Polyclonal specifically detects ADAT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAT1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9NVB7
• Gene Symbols: ADAT1
• Immunogen: Synthetic peptides corresponding to ADAT1 (adenosine deaminase, tRNA-specific 1) The peptide sequence was selected from the C terminal of ADAT1. Peptide sequence RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adenosine deaminase acting on tRNA, adenosine deaminase, tRNA-specific 1, EC 3.5.4, EC 3.5.4.-, HADAT1, tRNA-specific adenosine deaminase 1, tRNA-specific adenosine-37 deaminase
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23536
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG