Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Adenine Nucleotide Translocase 1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$104.00 - $345.50

Specifications

Antigen Adenine Nucleotide Translocase 1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB120096
View Documents
Novus Biologicals
NBP31097425UL
25 μg
Each for $104.00
Add to cart
 
NB120095
View Documents
Novus Biologicals
NBP310974100UL
100 μg
Each for $345.50
Add to cart
 
Description

Description

Adenine Nucleotide Translocase 1 Polyclonal antibody specifically detects Adenine Nucleotide Translocase 1 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

Adenine Nucleotide Translocase 1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
291
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Adenine Nucleotide Translocase 1 (NP_031476.3). Peptide sequence AVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit