Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adenylate Cyclase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | Adenylate Cyclase 5 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Adenylate Cyclase 5 Polyclonal specifically detects Adenylate Cyclase 5 in Human samples. It is validated for Western Blot.Specifications
Adenylate Cyclase 5 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
PBS buffer, 2% sucrose | |
111 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1 | |
The immunogen is a synthetic peptide directed towards the middle region of human Adenylate Cyclase 5 (NP_001186571.1). Peptide sequence EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title