Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADSSL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155524
Description
ADSSL1 Polyclonal specifically detects ADSSL1 in Human samples. It is validated for Western Blot.Specifications
ADSSL1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
adenylosuccinate synthase like 1, adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, ADSL1, AdSS 1, ADSS1, AMPSase 1, EC 6.3.4.4, FLJ38602, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase | |
Rabbit | |
50 kDa | |
100 μL | |
Lipid and Metabolism | |
122622 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8N142 | |
ADSSL1 | |
Synthetic peptides corresponding to ADSSL1(adenylosuccinate synthase like 1) The peptide sequence was selected from the middle region of ADSSL1 (NP_689541). Peptide sequence VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction