Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADSSL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ADSSL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15552420
View Documents
Novus Biologicals
NBP15552420UL
20 μL
Each for $152.22
Add to cart
 
NBP155524
View Documents
Novus Biologicals
NBP155524
100 μL
Each for $436.00
Add to cart
 
Description

Description

ADSSL1 Polyclonal specifically detects ADSSL1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ADSSL1
Polyclonal
Rabbit
Lipid and Metabolism
Q8N142
122622
Synthetic peptides corresponding to ADSSL1(adenylosuccinate synthase like 1) The peptide sequence was selected from the middle region of ADSSL1 (NP_689541). Peptide sequence VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
adenylosuccinate synthase like 1, adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, ADSL1, AdSS 1, ADSS1, AMPSase 1, EC 6.3.4.4, FLJ38602, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase
ADSSL1
IgG
Affinity Purified
50 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit