Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADSSL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | ADSSL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15552420
|
Novus Biologicals
NBP15552420UL |
20 μL |
Each for $152.22
|
|
NBP155524
|
Novus Biologicals
NBP155524 |
100 μL |
Each for $436.00
|
|
Description
ADSSL1 Polyclonal specifically detects ADSSL1 in Human samples. It is validated for Western Blot.Specifications
| ADSSL1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q8N142 | |
| 122622 | |
| Synthetic peptides corresponding to ADSSL1(adenylosuccinate synthase like 1) The peptide sequence was selected from the middle region of ADSSL1 (NP_689541). Peptide sequence VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| adenylosuccinate synthase like 1, adenylosuccinate synthetase isozyme 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate synthetase, muscle isozyme, ADSL1, AdSS 1, ADSS1, AMPSase 1, EC 6.3.4.4, FLJ38602, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase | |
| ADSSL1 | |
| IgG | |
| Affinity Purified | |
| 50 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title