Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADTB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ADTB1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP168947
|
Novus Biologicals
NBP168947 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ADTB1 Polyclonal specifically detects ADTB1 in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
ADTB1 | |
Unconjugated | |
RUO | |
Q10567 | |
AP1B1 | |
IgG | |
This product is specific to Subunit or Isoform: beta-1. |
Polyclonal | |
Rabbit | |
Membrane Vesicle Markers | |
162 | |
Synthetic peptides corresponding to AP1B1 (adaptor-related protein complex 1, beta 1 subunit) The peptide sequence was selected from the C terminal of AP1B1. Peptide sequence KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE. | |
Primary | |
104 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title