Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AFG3L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen AFG3L2
Applications Western Blot, ELISA
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159572
View Documents
Novus Biologicals
NBP159572
100 μL
Each of 1 for $436.00
N/A
Description

Description

AFG3L2 Polyclonal specifically detects AFG3L2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

AFG3L2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
AFG3 (ATPase family gene 3, yeast)-like 2, AFG3 ATPase family gene 3-like 2 (S. cerevisiae), AFG3 ATPase family gene 3-like 2 (yeast), AFG3-like protein 2, ATPase family gene 3, yeast, EC 3.4.24, EC 3.4.24.-, FLJ25993, Paraplegin-like protein, SCA28, spinocerebellar ataxia 28
AFG3L2
IgG
Affinity Purified
88 kDa
Western Blot, ELISA
Unconjugated
RUO
Q9Y4W6
10939
Synthetic peptides corresponding to AFG3L2 (AFG3 ATPase family gene 3-like 2 (yeast) The peptide sequence was selected from the middle region of AFG3L2. Peptide sequence VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit