Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AFG3L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | AFG3L2 |
---|---|
Applications | Western Blot, ELISA |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159572
|
Novus Biologicals
NBP159572 |
100 μL |
Each of 1 for $436.00
|
N/A |
Description
AFG3L2 Polyclonal specifically detects AFG3L2 in Human samples. It is validated for Western Blot.Specifications
AFG3L2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AFG3 (ATPase family gene 3, yeast)-like 2, AFG3 ATPase family gene 3-like 2 (S. cerevisiae), AFG3 ATPase family gene 3-like 2 (yeast), AFG3-like protein 2, ATPase family gene 3, yeast, EC 3.4.24, EC 3.4.24.-, FLJ25993, Paraplegin-like protein, SCA28, spinocerebellar ataxia 28 | |
AFG3L2 | |
IgG | |
Affinity Purified | |
88 kDa |
Western Blot, ELISA | |
Unconjugated | |
RUO | |
Q9Y4W6 | |
10939 | |
Synthetic peptides corresponding to AFG3L2 (AFG3 ATPase family gene 3-like 2 (yeast) The peptide sequence was selected from the middle region of AFG3L2. Peptide sequence VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title